PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_152090_niei.t1
Common NameSOVF_152090
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family GATA
Protein Properties Length: 150aa    MW: 15999.2 Da    PI: 10.0765
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_152090_niei.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.22.2e-182761135
               GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                       C+ C+tt TplWR gp g+ktLCnaCG++y kk++
  Sp_152090_niei.t1 27 CTDCQTTATPLWRGGPAGPKTLCNACGIKYHKKRR 61
                       ********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004014.3E-122180IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.9E-132261No hitNo description
PROSITE profilePS5011412.4262556IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.6E-152661IPR013088Zinc finger, NHR/GATA-type
CDDcd002029.81E-122661No hitNo description
PfamPF003205.4E-162761IPR000679Zinc finger, GATA-type
PROSITE patternPS0034402752IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MLDLKEEQQP CSVSESHSSS SELLKRCTDC QTTATPLWRG GPAGPKTLCN ACGIKYHKKR  60
RALLGLDKSK IDKNNNKKKT NKSCGGGSSN SSGSSSSNGS ESRHGITSLK IKMMASGGIR  120
QSGEKLRDKL GEVEQAAMLL MALSYGSVYA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010684625.12e-53PREDICTED: GATA transcription factor 15-like isoform X1
TrEMBLA0A0K9QSF51e-105A0A0K9QSF5_SPIOL; Uncharacterized protein
STRINGVIT_05s0077g01450.t014e-32(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49300.14e-25GATA transcription factor 16